Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BHLHB2 monoclonal antibody (M01), clone 5B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about BHLHB2 monoclonal antibody (M01), clone 5B1
| Brand: | Abnova |
| Reference: | H00008553-M01 |
| Product name: | BHLHB2 monoclonal antibody (M01), clone 5B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BHLHB2. |
| Clone: | 5B1 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8553 |
| Gene name: | BHLHE40 |
| Gene alias: | BHLHB2|DEC1|FLJ99214|SHARP-2|STRA13|Stra14 |
| Gene description: | basic helix-loop-helix family, member e40 |
| Genbank accession: | NM_003670 |
| Immunogen: | BHLHB2 (NP_003661, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH |
| Protein accession: | NP_003661 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | BHLHB2 monoclonal antibody (M01), clone 5B1 Western Blot analysis of BHLHB2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | MicroRNA-18a inhibits hypoxia-inducible factor 1-alpha activity and lung metastasis in basal breast cancers.Krutilina R, Sun W, Sethuraman A, Brown M, Seagroves TN, Pfeffer LM, Ignatova T, Fan M Breast Cancer Res. 2014 Jul 28;16(4):R78. |