Brand: | Abnova |
Reference: | H00008550-M01 |
Product name: | MAPKAPK5 monoclonal antibody (M01), clone 2D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPKAPK5. |
Clone: | 2D5 |
Isotype: | IgG1 Kappa |
Gene id: | 8550 |
Gene name: | MAPKAPK5 |
Gene alias: | PRAK |
Gene description: | mitogen-activated protein kinase-activated protein kinase 5 |
Genbank accession: | BC047284 |
Immunogen: | MAPKAPK5 (AAH47284, 371 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ |
Protein accession: | AAH47284 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAPKAPK5 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |