Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FCN3 monoclonal antibody (M01A), clone 4B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about FCN3 monoclonal antibody (M01A), clone 4B4
| Brand: | Abnova |
| Reference: | H00008547-M01A |
| Product name: | FCN3 monoclonal antibody (M01A), clone 4B4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FCN3. |
| Clone: | 4B4 |
| Isotype: | IgM Kappa |
| Gene id: | 8547 |
| Gene name: | FCN3 |
| Gene alias: | FCNH|HAKA1|MGC22543 |
| Gene description: | ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) |
| Genbank accession: | BC020731 |
| Immunogen: | FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
| Protein accession: | AAH20731 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FCN3 expression in transfected 293T cell line by FCN3 monoclonal antibody (M01A), clone 4B4. Lane 1: FCN3 transfected lysate(31.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |