H00008547-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00008547-M01A |
Product name: | FCN3 monoclonal antibody (M01A), clone 4B4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FCN3. |
Clone: | 4B4 |
Isotype: | IgM Kappa |
Gene id: | 8547 |
Gene name: | FCN3 |
Gene alias: | FCNH|HAKA1|MGC22543 |
Gene description: | ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) |
Genbank accession: | BC020731 |
Immunogen: | FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
Protein accession: | AAH20731 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (57.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FCN3 expression in transfected 293T cell line by FCN3 monoclonal antibody (M01A), clone 4B4. Lane 1: FCN3 transfected lysate(31.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |