FCN3 monoclonal antibody (M01A), clone 4B4 View larger

FCN3 monoclonal antibody (M01A), clone 4B4

H00008547-M01A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FCN3 monoclonal antibody (M01A), clone 4B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about FCN3 monoclonal antibody (M01A), clone 4B4

Brand: Abnova
Reference: H00008547-M01A
Product name: FCN3 monoclonal antibody (M01A), clone 4B4
Product description: Mouse monoclonal antibody raised against a full-length recombinant FCN3.
Clone: 4B4
Isotype: IgM Kappa
Gene id: 8547
Gene name: FCN3
Gene alias: FCNH|HAKA1|MGC22543
Gene description: ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Genbank accession: BC020731
Immunogen: FCN3 (AAH20731, 1 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Protein accession: AAH20731
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008547-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008547-M01A-13-15-1.jpg
Application image note: Western Blot analysis of FCN3 expression in transfected 293T cell line by FCN3 monoclonal antibody (M01A), clone 4B4.

Lane 1: FCN3 transfected lysate(31.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy FCN3 monoclonal antibody (M01A), clone 4B4 now

Add to cart