Brand: | Abnova |
Reference: | H00008546-M06 |
Product name: | AP3B1 monoclonal antibody (M06), clone 3B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AP3B1. |
Clone: | 3B4 |
Isotype: | IgG2a Kappa |
Gene id: | 8546 |
Gene name: | AP3B1 |
Gene alias: | ADTB3|ADTB3A|HPS|HPS2|PE |
Gene description: | adaptor-related protein complex 3, beta 1 subunit |
Genbank accession: | NM_003664 |
Immunogen: | AP3B1 (NP_003655, 995 a.a. ~ 1094 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG |
Protein accession: | NP_003655 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008546-M06-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008546-M06-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008546-M06-9-20-1.jpg](http://www.abnova.com/application_image/H00008546-M06-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged AP3B1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |