Brand: | Abnova |
Reference: | H00008545-M02 |
Product name: | CGGBP1 monoclonal antibody (M02), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CGGBP1. |
Clone: | 1D11 |
Isotype: | IgG1 Kappa |
Gene id: | 8545 |
Gene name: | CGGBP1 |
Gene alias: | CGGBP|p20-CGGBP |
Gene description: | CGG triplet repeat binding protein 1 |
Genbank accession: | NM_003663 |
Immunogen: | CGGBP1 (NP_003654, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC |
Protein accession: | NP_003654 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | CGGBP1 monoclonal antibody (M02), clone 1D11 Western Blot analysis of CGGBP1 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |