PIR purified MaxPab mouse polyclonal antibody (B01P) View larger

PIR purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIR purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about PIR purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008544-B01P
Product name: PIR purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PIR protein.
Gene id: 8544
Gene name: PIR
Gene alias: -
Gene description: pirin (iron-binding nuclear protein)
Genbank accession: NM_003662.2
Immunogen: PIR (NP_003653.1, 1 a.a. ~ 290 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Protein accession: NP_003653.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008544-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PIR expression in transfected 293T cell line (H00008544-T01) by PIR MaxPab polyclonal antibody.

Lane 1: PIR transfected lysate(31.9 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PIR purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart