Brand: | Abnova |
Reference: | H00008543-M04 |
Product name: | LMO4 monoclonal antibody (M04), clone 3B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LMO4. |
Clone: | 3B4 |
Isotype: | IgG2a Kappa |
Gene id: | 8543 |
Gene name: | LMO4 |
Gene alias: | - |
Gene description: | LIM domain only 4 |
Genbank accession: | NM_006769 |
Immunogen: | LMO4 (NP_006760, 57 a.a. ~ 165 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
Protein accession: | NP_006760 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008543-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008543-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |