APOL1 purified MaxPab mouse polyclonal antibody (B01P) View larger

APOL1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOL1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about APOL1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008542-B01P
Product name: APOL1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human APOL1 protein.
Gene id: 8542
Gene name: APOL1
Gene alias: APO-L|APOL|APOL-I
Gene description: apolipoprotein L, 1
Genbank accession: BC017331.1
Immunogen: APOL1 (AAH17331.1, 1 a.a. ~ 238 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA
Protein accession: AAH17331.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008542-B01P-2-A7-1.jpg
Application image note: APOL1 MaxPab polyclonal antibody. Western Blot analysis of APOL1 expression in human pancreas.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy APOL1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart