BCAS1 monoclonal antibody (M03), clone 1B5 View larger

BCAS1 monoclonal antibody (M03), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCAS1 monoclonal antibody (M03), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about BCAS1 monoclonal antibody (M03), clone 1B5

Brand: Abnova
Reference: H00008537-M03
Product name: BCAS1 monoclonal antibody (M03), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant BCAS1.
Clone: 1B5
Isotype: IgG2a Kappa
Gene id: 8537
Gene name: BCAS1
Gene alias: AIBC1|NABC1
Gene description: breast carcinoma amplified sequence 1
Genbank accession: NM_003657
Immunogen: BCAS1 (NP_003648, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL
Protein accession: NP_003648
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008537-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.54 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008537-M03-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BCAS1 monoclonal antibody (M03), clone 1B5 now

Add to cart