Brand: | Abnova |
Reference: | H00008537-M03 |
Product name: | BCAS1 monoclonal antibody (M03), clone 1B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BCAS1. |
Clone: | 1B5 |
Isotype: | IgG2a Kappa |
Gene id: | 8537 |
Gene name: | BCAS1 |
Gene alias: | AIBC1|NABC1 |
Gene description: | breast carcinoma amplified sequence 1 |
Genbank accession: | NM_003657 |
Immunogen: | BCAS1 (NP_003648, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNQMSVPQRVEDQENEPEAETYQDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNL |
Protein accession: | NP_003648 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to BCAS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |