Brand: | Abnova |
Reference: | H00008533-M02 |
Product name: | COPS3 monoclonal antibody (M02), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant COPS3. |
Clone: | 2D10 |
Isotype: | IgG2a Kappa |
Gene id: | 8533 |
Gene name: | COPS3 |
Gene alias: | CSN3|SGN3 |
Gene description: | COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) |
Genbank accession: | NM_003653 |
Immunogen: | COPS3 (NP_003644, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY |
Protein accession: | NP_003644 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008533-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008533-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![H00008533-M02-4-1-1-L.jpg](http://www.abnova.com/application_image/H00008533-M02-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to COPS3 on HeLa cell. [antibody concentration 20 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |