CSDA purified MaxPab rabbit polyclonal antibody (D01P) View larger

CSDA purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSDA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about CSDA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008531-D01P
Product name: CSDA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CSDA protein.
Gene id: 8531
Gene name: CSDA
Gene alias: CSDA1|DBPA|ZONAB
Gene description: cold shock domain protein A
Genbank accession: BC015564.1
Immunogen: CSDA (AAH15564.1, 1 a.a. ~ 372 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE
Protein accession: AAH15564.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008531-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CSDA expression in transfected 293T cell line (H00008531-T04) by CSDA MaxPab polyclonal antibody.

Lane 1: CSDA transfected lysate(40.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSDA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart