DDO monoclonal antibody (M09), clone 3F7 View larger

DDO monoclonal antibody (M09), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDO monoclonal antibody (M09), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DDO monoclonal antibody (M09), clone 3F7

Brand: Abnova
Reference: H00008528-M09
Product name: DDO monoclonal antibody (M09), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant DDO.
Clone: 3F7
Isotype: IgG2a Kappa
Gene id: 8528
Gene name: DDO
Gene alias: DASOX|DDO-1|DDO-2|FLJ45203
Gene description: D-aspartate oxidase
Genbank accession: NM_003649
Immunogen: DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Protein accession: NP_003640
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008528-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008528-M09-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DDO is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DDO monoclonal antibody (M09), clone 3F7 now

Add to cart