Brand: | Abnova |
Reference: | H00008528-A01 |
Product name: | DDO polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DDO. |
Gene id: | 8528 |
Gene name: | DDO |
Gene alias: | DASOX|DDO-1|DDO-2|FLJ45203 |
Gene description: | D-aspartate oxidase |
Genbank accession: | NM_003649 |
Immunogen: | DDO (NP_003640, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL |
Protein accession: | NP_003640 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008528-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008528-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008528-A01-2-A5-1.jpg](http://www.abnova.com/application_image/H00008528-A01-2-A5-1.jpg) |
Application image note: | DDO polyclonal antibody (A01). Western Blot analysis of DDO expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | D-Aspartate and D-Aspartate Oxidase Show Selective and Developmentally Dynamic Localization in Mouse Retina.Huang AS, Lee DA, Blackshaw S. Exp Eye Res. 2008 Apr;86(4):704-9. Epub 2008 Jan 25. |