Brand: | Abnova |
Reference: | H00008526-M03 |
Product name: | DGKE monoclonal antibody (M03), clone 7E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DGKE. |
Clone: | 7E1 |
Isotype: | IgG3 Lambda |
Gene id: | 8526 |
Gene name: | DGKE |
Gene alias: | DAGK6|DGK |
Gene description: | diacylglycerol kinase, epsilon 64kDa |
Genbank accession: | NM_003647 |
Immunogen: | DGKE (NP_003638, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF |
Protein accession: | NP_003638 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008526-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008526-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00008526-M03-1-1-1.jpg](http://www.abnova.com/application_image/H00008526-M03-1-1-1.jpg) |
Application image note: | DGKE monoclonal antibody (M03), clone 7E1 Western Blot analysis of DGKE expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |