GCM1 monoclonal antibody (M04), clone 4E8 View larger

GCM1 monoclonal antibody (M04), clone 4E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCM1 monoclonal antibody (M04), clone 4E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA

More info about GCM1 monoclonal antibody (M04), clone 4E8

Brand: Abnova
Reference: H00008521-M04
Product name: GCM1 monoclonal antibody (M04), clone 4E8
Product description: Mouse monoclonal antibody raised against a partial recombinant GCM1.
Clone: 4E8
Isotype: IgG2a Kappa
Gene id: 8521
Gene name: GCM1
Gene alias: GCMA|hGCMa
Gene description: glial cells missing homolog 1 (Drosophila)
Genbank accession: NM_003643
Immunogen: GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Protein accession: NP_003634
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008521-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GCM1 monoclonal antibody (M04), clone 4E8 now

Add to cart