Brand: | Abnova |
Reference: | H00008521-M01 |
Product name: | GCM1 monoclonal antibody (M01), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GCM1. |
Clone: | 3D2 |
Isotype: | IgG2b Kappa |
Gene id: | 8521 |
Gene name: | GCM1 |
Gene alias: | GCMA|hGCMa |
Gene description: | glial cells missing homolog 1 (Drosophila) |
Genbank accession: | NM_003643 |
Immunogen: | GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* |
Protein accession: | NP_003634 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GCM1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |