Brand: | Abnova |
Reference: | H00008519-M01 |
Product name: | IFITM1 monoclonal antibody (M01), clone 1F8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IFITM1. |
Clone: | 1F8 |
Isotype: | IgG2b Kappa |
Gene id: | 8519 |
Gene name: | IFITM1 |
Gene alias: | 9-27|CD225|IFI17|LEU13 |
Gene description: | interferon induced transmembrane protein 1 (9-27) |
Genbank accession: | BC000897 |
Immunogen: | IFITM1 (AAH00897, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
Protein accession: | AAH00897 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (39.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged IFITM1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |