IFITM1 purified MaxPab mouse polyclonal antibody (B01P) View larger

IFITM1 purified MaxPab mouse polyclonal antibody (B01P)

H00008519-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFITM1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about IFITM1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008519-B01P
Product name: IFITM1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IFITM1 protein.
Gene id: 8519
Gene name: IFITM1
Gene alias: 9-27|CD225|IFI17|LEU13
Gene description: interferon induced transmembrane protein 1 (9-27)
Genbank accession: BC000897
Immunogen: IFITM1 (AAH00897, 1 a.a. ~ 125 a.a) full-length human protein.
Immunogen sequence/protein sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Protein accession: AAH00897
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008519-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IFITM1 expression in transfected 293T cell line (H00008519-T01) by IFITM1 MaxPab polyclonal antibody.

Lane 1: IFITM1 transfected lysate(11.66 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFITM1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart