Brand: | Abnova |
Reference: | H00008510-M02 |
Product name: | MMP23B monoclonal antibody (M02), clone 1D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MMP23B. |
Clone: | 1D8 |
Isotype: | IgG2a Kappa |
Gene id: | 8510 |
Gene name: | MMP23B |
Gene alias: | MIFR|MIFR-1|MMP22 |
Gene description: | matrix metallopeptidase 23B |
Genbank accession: | NM_006983 |
Immunogen: | MMP23B (NP_008914, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP |
Protein accession: | NP_008914 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008510-M02-9-18-1.jpg](http://www.abnova.com/application_image/H00008510-M02-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged MMP23B is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |