Brand: | Abnova |
Reference: | H00008507-M02 |
Product name: | ENC1 monoclonal antibody (M02), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENC1. |
Clone: | 3B1 |
Isotype: | IgG1 Kappa |
Gene id: | 8507 |
Gene name: | ENC1 |
Gene alias: | CCL28|ENC-1|FLJ39259|KLHL35|KLHL37|NRPB|PIG10|TP53I10 |
Gene description: | ectodermal-neural cortex (with BTB-like domain) |
Genbank accession: | NM_003633 |
Immunogen: | ENC1 (NP_003624, 17 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVL |
Protein accession: | NP_003624 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | ENC1 monoclonal antibody (M02), clone 3B1 Western Blot analysis of ENC1 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Characterization of Differential Gene Expression in Adrenocortical Tumors Harboring {beta}-Catenin (CTNNB1) Mutations.Durand J, Lampron A, Mazzuco TL, Chapman A, Bourdeau I. J Clin Endocrinol Metab. 2011 May 11. [Epub ahead of print] |