Brand: | Abnova |
Reference: | H00008502-M01 |
Product name: | PKP4 monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PKP4. |
Clone: | 1B2 |
Isotype: | IgG2a Kappa |
Gene id: | 8502 |
Gene name: | PKP4 |
Gene alias: | FLJ31261|FLJ42243|p0071 |
Gene description: | plakophilin 4 |
Genbank accession: | NM_001005476 |
Immunogen: | PKP4 (NP_001005476, 12 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ |
Protein accession: | NP_001005476 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PKP4 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A molecular study of desmosomes identifies a desmoglein isoform switch in head and neck squamous cell carcinoma.Teh MT, Ken Parkinson E, Thurlow JK, Liu F, Fortune F, Wan H. J Oral Pathol Med. 2010 Oct 4. doi: 10.1111/j.1600-0714.2010.00951.x. [Epub ahead of print] |