Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008493-M01 |
Product name: | PPM1D monoclonal antibody (M01), clone 4D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPM1D. |
Clone: | 4D1 |
Isotype: | IgG1 Kappa |
Gene id: | 8493 |
Gene name: | PPM1D |
Gene alias: | PP2C-DELTA|WIP1 |
Gene description: | protein phosphatase 1D magnesium-dependent, delta isoform |
Genbank accession: | NM_003620 |
Immunogen: | PPM1D (NP_003611, 496 a.a. ~ 605 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC |
Protein accession: | NP_003611 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PPM1D expression in transfected 293T cell line by PPM1D monoclonal antibody (M01), clone 4D1. Lane 1: PPM1D transfected lysate(66.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |