CILP monoclonal antibody (M01), clone 2C5 View larger

CILP monoclonal antibody (M01), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CILP monoclonal antibody (M01), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CILP monoclonal antibody (M01), clone 2C5

Brand: Abnova
Reference: H00008483-M01
Product name: CILP monoclonal antibody (M01), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant CILP.
Clone: 2C5
Isotype: IgG1 Kappa
Gene id: 8483
Gene name: CILP
Gene alias: CILP-1|HsT18872
Gene description: cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
Genbank accession: NM_003613
Immunogen: CILP (NP_003604, 129 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML
Protein accession: NP_003604
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008483-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CILP is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CILP monoclonal antibody (M01), clone 2C5 now

Add to cart