SMARCA5 polyclonal antibody (A01) View larger

SMARCA5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCA5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SMARCA5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00008467-A01
Product name: SMARCA5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SMARCA5.
Gene id: 8467
Gene name: SMARCA5
Gene alias: ISWI|SNF2H|WCRF135|hISWI|hSNF2H
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Genbank accession: NM_003601
Immunogen: SMARCA5 (NP_003592, 59 a.a. ~ 147 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
Protein accession: NP_003592
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008467-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008467-A01-1-35-1.jpg
Application image note: SMARCA5 polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of SMARCA5 expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMARCA5 polyclonal antibody (A01) now

Add to cart