TEAD2 monoclonal antibody (M01A), clone 2D5 View larger

TEAD2 monoclonal antibody (M01A), clone 2D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEAD2 monoclonal antibody (M01A), clone 2D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TEAD2 monoclonal antibody (M01A), clone 2D5

Brand: Abnova
Reference: H00008463-M01A
Product name: TEAD2 monoclonal antibody (M01A), clone 2D5
Product description: Mouse monoclonal antibody raised against a partial recombinant TEAD2.
Clone: 2D5
Isotype: IgG2a Kappa
Gene id: 8463
Gene name: TEAD2
Gene alias: ETF|TEF-4|TEF4
Gene description: TEA domain family member 2
Genbank accession: NM_003598
Immunogen: TEAD2 (NP_003589, 218 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN
Protein accession: NP_003589
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice
Publications: Elevated expression of Par3 promotes prostate cancer metastasis by forming a Par3/aPKC/KIBRA complex and inactivating the hippo pathway.Zhou PJ, Xue W, Peng J, Wang Y, Wei L, Yang Z, Zhu HH, Fang YX, Gao WQ.
J Exp Clin Cancer Res. 2017 Oct 10;36(1):139.

Reviews

Buy TEAD2 monoclonal antibody (M01A), clone 2D5 now

Add to cart