Brand: | Abnova |
Reference: | H00008458-M06 |
Product name: | TTF2 monoclonal antibody (M06), clone 1E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TTF2. |
Clone: | 1E8 |
Isotype: | IgG2a Kappa |
Gene id: | 8458 |
Gene name: | TTF2 |
Gene alias: | HuF2 |
Gene description: | transcription termination factor, RNA polymerase II |
Genbank accession: | NM_003594 |
Immunogen: | TTF2 (NP_003585, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK |
Protein accession: | NP_003585 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | TTF2 monoclonal antibody (M06), clone 1E8. Western Blot analysis of TTF2 expression in human placenta. |
Applications: | WB-Ce,WB-Ti,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |