Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008445-M03 |
Product name: | DYRK2 monoclonal antibody (M03), clone 4G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DYRK2. |
Clone: | 4G11 |
Isotype: | IgG1 Kappa |
Gene id: | 8445 |
Gene name: | DYRK2 |
Gene alias: | FLJ21217|FLJ21365 |
Gene description: | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 |
Genbank accession: | BC005809 |
Immunogen: | DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH |
Protein accession: | AAH05809 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DYRK2 expression in transfected 293T cell line by DYRK2 monoclonal antibody (M03), clone 4G11. Lane 1: DYRK2 transfected lysate(59.72 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |