DYRK2 monoclonal antibody (M01), clone 3G5 View larger

DYRK2 monoclonal antibody (M01), clone 3G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DYRK2 monoclonal antibody (M01), clone 3G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DYRK2 monoclonal antibody (M01), clone 3G5

Brand: Abnova
Reference: H00008445-M01
Product name: DYRK2 monoclonal antibody (M01), clone 3G5
Product description: Mouse monoclonal antibody raised against a partial recombinant DYRK2.
Clone: 3G5
Isotype: IgG2a Kappa
Gene id: 8445
Gene name: DYRK2
Gene alias: FLJ21217|FLJ21365
Gene description: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Genbank accession: BC005809
Immunogen: DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH
Protein accession: AAH05809
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008445-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008445-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged DYRK2 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DYRK2 monoclonal antibody (M01), clone 3G5 now

Add to cart