STK24 monoclonal antibody (M04), clone 3F2 View larger

STK24 monoclonal antibody (M04), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STK24 monoclonal antibody (M04), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about STK24 monoclonal antibody (M04), clone 3F2

Brand: Abnova
Reference: H00008428-M04
Product name: STK24 monoclonal antibody (M04), clone 3F2
Product description: Mouse monoclonal antibody raised against a full-length recombinant STK24.
Clone: 3F2
Isotype: IgG2a Kappa
Gene id: 8428
Gene name: STK24
Gene alias: MST-3|MST3|MST3B|STE20|STK3
Gene description: serine/threonine kinase 24 (STE20 homolog, yeast)
Genbank accession: BC035578
Immunogen: STK24 (AAH35578, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
Protein accession: AAH35578
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008428-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (73.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008428-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged STK24 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STK24 monoclonal antibody (M04), clone 3F2 now

Add to cart