BCAR3 monoclonal antibody (M01), clone 3G4 View larger

BCAR3 monoclonal antibody (M01), clone 3G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCAR3 monoclonal antibody (M01), clone 3G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about BCAR3 monoclonal antibody (M01), clone 3G4

Brand: Abnova
Reference: H00008412-M01
Product name: BCAR3 monoclonal antibody (M01), clone 3G4
Product description: Mouse monoclonal antibody raised against a partial recombinant BCAR3.
Clone: 3G4
Isotype: IgG2a Kappa
Gene id: 8412
Gene name: BCAR3
Gene alias: KIAA0554|NSP2|SH2D3B
Gene description: breast cancer anti-estrogen resistance 3
Genbank accession: BC039895
Immunogen: BCAR3 (AAH39895, 266 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA
Protein accession: AAH39895
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008412-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008412-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged BCAR3 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BCAR3 monoclonal antibody (M01), clone 3G4 now

Add to cart