Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EEA1 monoclonal antibody (M02A), clone 1D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EEA1 monoclonal antibody (M02A), clone 1D4
| Brand: | Abnova |
| Reference: | H00008411-M02A |
| Product name: | EEA1 monoclonal antibody (M02A), clone 1D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EEA1. |
| Clone: | 1D4 |
| Isotype: | IgG |
| Gene id: | 8411 |
| Gene name: | EEA1 |
| Gene alias: | MST105|MSTP105|ZFYVE2 |
| Gene description: | early endosome antigen 1 |
| Genbank accession: | NM_003566 |
| Immunogen: | EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
| Protein accession: | NP_003557 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EEA1 monoclonal antibody (M02A), clone 1D4 Western Blot analysis of EEA1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AmotL2 disrupts apical-basal cell polarity and promotes tumour invasion.Mojallal M, Zheng Y, Hultin S, Audebert S, van Harn T, Johnsson P, Lenander C, Fritz N, Mieth C, Corcoran M, Lembo F, Hallstrom M, Hartman J, Mazure NM, Weide T, Grander D, Borg JP, Uhlen P, Holmgren L Nat Commun. 2014 Aug 1;5:4557. doi: 10.1038/ncomms5557. |