Brand: | Abnova |
Reference: | H00008411-A01 |
Product name: | EEA1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EEA1. |
Gene id: | 8411 |
Gene name: | EEA1 |
Gene alias: | MST105|MSTP105|ZFYVE2 |
Gene description: | early endosome antigen 1 |
Genbank accession: | NM_003566 |
Immunogen: | EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
Protein accession: | NP_003557 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | EEA1 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of EEA1 expression in Raw 264.7. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |