PLA2G10 monoclonal antibody (M01), clone 5G11 View larger

PLA2G10 monoclonal antibody (M01), clone 5G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLA2G10 monoclonal antibody (M01), clone 5G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PLA2G10 monoclonal antibody (M01), clone 5G11

Brand: Abnova
Reference: H00008399-M01
Product name: PLA2G10 monoclonal antibody (M01), clone 5G11
Product description: Mouse monoclonal antibody raised against a partial recombinant PLA2G10.
Clone: 5G11
Isotype: IgG1 Kappa
Gene id: 8399
Gene name: PLA2G10
Gene alias: GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2
Gene description: phospholipase A2, group X
Genbank accession: NM_003561
Immunogen: PLA2G10 (NP_003552.1, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Protein accession: NP_003552.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008399-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008399-M01-13-15-1.jpg
Application image note: Western Blot analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 monoclonal antibody (M01), clone 5G11.

Lane 1: PLA2G10 transfected lysate (Predicted MW: 18.2 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLA2G10 monoclonal antibody (M01), clone 5G11 now

Add to cart