Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008399-M01 |
Product name: | PLA2G10 monoclonal antibody (M01), clone 5G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLA2G10. |
Clone: | 5G11 |
Isotype: | IgG1 Kappa |
Gene id: | 8399 |
Gene name: | PLA2G10 |
Gene alias: | GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2 |
Gene description: | phospholipase A2, group X |
Genbank accession: | NM_003561 |
Immunogen: | PLA2G10 (NP_003552.1, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD |
Protein accession: | NP_003552.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 monoclonal antibody (M01), clone 5G11. Lane 1: PLA2G10 transfected lysate (Predicted MW: 18.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |