Cart 121 Product Products 46 356,48 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Cleaved-Ca...259,07 € -
-
-
-
-
-
-
-
1 x Galectin-3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
46 356,48 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 121 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 46 356,48 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 46 356,48 €
Data sheet of PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00008399-D01P |
| Product name: | PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PLA2G10 protein. |
| Gene id: | 8399 |
| Gene name: | PLA2G10 |
| Gene alias: | GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2 |
| Gene description: | phospholipase A2, group X |
| Genbank accession: | NM_003561.1 |
| Immunogen: | PLA2G10 (NP_003552.1, 1 a.a. ~ 165 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD |
| Protein accession: | NP_003552.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PLA2G10 expression in transfected 293T cell line (H00008399-T02) by PLA2G10 MaxPab polyclonal antibody. Lane 1: PLA2G10 transfected lysate(18.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | HDAC Inhibition Induces Increased Choline Uptake and Elevated Phosphocholine Levels in MCF7 Breast Cancer Cells.Ward CS, Eriksson P, Izquierdo-Garcia JL, Brandes AH, Ronen SM PLoS One. 2013 Apr 23;8(4):e62610. doi: 10.1371/journal.pone.0062610. Print 2013. |