Brand: | Abnova |
Reference: | H00008387-G01 |
Product name: | OR1E1 (Human) Recombinant Protein |
Product description: | Human OR1E1 full-length ORF (ENSP00000313384) recombinant protein without tag. |
Gene id: | 8387 |
Gene name: | OR1E1 |
Gene alias: | HGM071|OR13-66|OR17-2|OR17-32|OR1E5|OR1E6|OR1E8P|OR1E9P|OST547 |
Gene description: | olfactory receptor, family 1, subfamily E, member 1 |
Genbank accession: | ENST00000322608 |
Immunogen sequence/protein sequence: | MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL |
Protein accession: | ENSP00000313384 |
Form: | Liquid |
Preparation method: | in vitro wheat germ expression system with proprietary liposome technology |
Recommend dilutions: | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage buffer: | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | None |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP |
Shipping condition: | Dry Ice |