Brand: | Abnova |
Reference: | H00008337-M01 |
Product name: | HIST2H2AA monoclonal antibody (M01), clone 4C10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HIST2H2AA. |
Clone: | 4C10 |
Isotype: | IgG2a Kappa |
Gene id: | 8337 |
Gene name: | HIST2H2AA3 |
Gene alias: | H2A|H2A.2|H2A/O|H2A/q|H2AFO|H2a-615|HIST2H2AA |
Gene description: | histone cluster 2, H2aa3 |
Genbank accession: | BC001629 |
Immunogen: | HIST2H2AA (AAH01629, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
Protein accession: | AAH01629 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.04 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to HIST2H2AA3 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |