Brand: | Abnova |
Reference: | H00008324-M03 |
Product name: | FZD7 monoclonal antibody (M03), clone 4D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD7. |
Clone: | 4D9 |
Isotype: | IgG1 Kappa |
Gene id: | 8324 |
Gene name: | FZD7 |
Gene alias: | FzE3 |
Gene description: | frizzled homolog 7 (Drosophila) |
Genbank accession: | NM_003507 |
Immunogen: | FZD7 (NP_003498.1, 155 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA |
Protein accession: | NP_003498.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FZD7 monoclonal antibody (M03), clone 4D9. Western Blot analysis of FZD7 expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |