Brand: | Abnova |
Reference: | H00008322-M02 |
Product name: | FZD4 monoclonal antibody (M02), clone 3G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD4. |
Clone: | 3G7 |
Isotype: | IgG2b Kappa |
Gene id: | 8322 |
Gene name: | FZD4 |
Gene alias: | CD344|EVR1|FEVR|FZD4S|Fz-4|FzE4|GPCR|MGC34390 |
Gene description: | frizzled homolog 4 (Drosophila) |
Genbank accession: | NM_012193 |
Immunogen: | FZD4 (NP_036325, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY |
Protein accession: | NP_036325 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FZD4 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |