USP11 monoclonal antibody (M01), clone 8G5 View larger

USP11 monoclonal antibody (M01), clone 8G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP11 monoclonal antibody (M01), clone 8G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about USP11 monoclonal antibody (M01), clone 8G5

Brand: Abnova
Reference: H00008237-M01
Product name: USP11 monoclonal antibody (M01), clone 8G5
Product description: Mouse monoclonal antibody raised against a partial recombinant USP11.
Clone: 8G5
Isotype: IgG2a Kappa
Gene id: 8237
Gene name: USP11
Gene alias: UHX1
Gene description: ubiquitin specific peptidase 11
Genbank accession: NM_004651
Immunogen: USP11 (NP_004642, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
Protein accession: NP_004642
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008237-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008237-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged USP11 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP11 monoclonal antibody (M01), clone 8G5 now

Add to cart