Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00008233-B01P |
Product name: | U2AF1L2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human U2AF1L2 protein. |
Gene id: | 8233 |
Gene name: | ZRSR2 |
Gene alias: | MGC142014|MGC142040|U2AF1-RS2|U2AF1L2|U2AF1RS2|URP |
Gene description: | zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2 |
Genbank accession: | NM_005089 |
Immunogen: | U2AF1L2 (NP_005080, 1 a.a. ~ 482 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK |
Protein accession: | NP_005080 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZRSR2 expression in transfected 293T cell line (H00008233-T01) by ZRSR2 MaxPab polyclonal antibody. Lane 1: U2AF1L2 transfected lysate(53.02 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |