SFRS17A monoclonal antibody (M02), clone 2G8 View larger

SFRS17A monoclonal antibody (M02), clone 2G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRS17A monoclonal antibody (M02), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SFRS17A monoclonal antibody (M02), clone 2G8

Brand: Abnova
Reference: H00008227-M02
Product name: SFRS17A monoclonal antibody (M02), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant RP13-297E16.1.
Clone: 2G8
Isotype: IgG2b Kappa
Gene id: 8227
Gene name: SFRS17A
Gene alias: 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y
Gene description: splicing factor, arginine/serine-rich 17A
Genbank accession: NM_005088
Immunogen: SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Protein accession: NP_005079
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008227-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008227-M02-1-25-1.jpg
Application image note: SFRS17A monoclonal antibody (M02), clone 2G8 Western Blot analysis of SFRS17A expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFRS17A monoclonal antibody (M02), clone 2G8 now

Add to cart