SFRS17A polyclonal antibody (A01) View larger

SFRS17A polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRS17A polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SFRS17A polyclonal antibody (A01)

Brand: Abnova
Reference: H00008227-A01
Product name: SFRS17A polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SFRS17A.
Gene id: 8227
Gene name: SFRS17A
Gene alias: 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y
Gene description: splicing factor, arginine/serine-rich 17A
Genbank accession: NM_005088
Immunogen: SFRS17A (NP_005079, 53 a.a. ~ 156 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPC
Protein accession: NP_005079
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008227-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SFRS17A polyclonal antibody (A01) now

Add to cart