CHAF1B monoclonal antibody (M01), clone 2G7 View larger

CHAF1B monoclonal antibody (M01), clone 2G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHAF1B monoclonal antibody (M01), clone 2G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CHAF1B monoclonal antibody (M01), clone 2G7

Brand: Abnova
Reference: H00008208-M01
Product name: CHAF1B monoclonal antibody (M01), clone 2G7
Product description: Mouse monoclonal antibody raised against a partial recombinant CHAF1B.
Clone: 2G7
Isotype: IgG2b Kappa
Gene id: 8208
Gene name: CHAF1B
Gene alias: CAF-1|CAF-IP60|CAF1|CAF1A|CAF1P60|MPHOSPH7|MPP7
Gene description: chromatin assembly factor 1, subunit B (p60)
Genbank accession: BC021218
Immunogen: CHAF1B (AAH21218, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL
Protein accession: AAH21218
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008208-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008208-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CHAF1B is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHAF1B monoclonal antibody (M01), clone 2G7 now

Add to cart