GDF5 monoclonal antibody (M06), clone 1F4 View larger

GDF5 monoclonal antibody (M06), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF5 monoclonal antibody (M06), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about GDF5 monoclonal antibody (M06), clone 1F4

Brand: Abnova
Reference: H00008200-M06
Product name: GDF5 monoclonal antibody (M06), clone 1F4
Product description: Mouse monoclonal antibody raised against a partial recombinant GDF5.
Clone: 1F4
Isotype: IgG2a Kappa
Gene id: 8200
Gene name: GDF5
Gene alias: BMP14|CDMP1|LAP4|SYNS2
Gene description: growth differentiation factor 5
Genbank accession: NM_000557.2
Immunogen: GDF5 (NP_000548.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: APDLGQRPQGTRPGLAKAEAKERPPLARNVFRPGGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATARTVTPKGQ
Protein accession: NP_000548.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008200-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008200-M06-1-2-1.jpg
Application image note: GDF5 monoclonal antibody (M06), clone 1F4. Western Blot analysis of GDF5 expression in HL-60.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GDF5 monoclonal antibody (M06), clone 1F4 now

Add to cart