Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MIA monoclonal antibody (M02), clone 3A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MIA monoclonal antibody (M02), clone 3A6
| Reference: | H00008190-M02 |
| Product name: | MIA monoclonal antibody (M02), clone 3A6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MIA. |
| Clone: | 3A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8190 |
| Gene name: | MIA |
| Gene alias: | CD-RAP |
| Gene description: | melanoma inhibitory activity |
| Genbank accession: | BC005910 |
| Immunogen: | MIA (AAH05910, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
| Protein accession: | AAH05910 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |