Brand: | Abnova |
Reference: | H00008175-M01 |
Product name: | SF3A2 monoclonal antibody (M01), clone 3B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SF3A2. |
Clone: | 3B6 |
Isotype: | IgG2b Kappa |
Gene id: | 8175 |
Gene name: | SF3A2 |
Gene alias: | PRP11|PRPF11|SAP62|SF3a66 |
Gene description: | splicing factor 3a, subunit 2, 66kDa |
Genbank accession: | NM_007165 |
Immunogen: | SF3A2 (NP_009096, 112 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK |
Protein accession: | NP_009096 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008175-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008175-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008175-M01-4-1-1-L.jpg](http://www.abnova.com/application_image/H00008175-M01-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to SF3A2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA Cell Cycle. 2012 Jun 15;11(12):2367-79. doi: 10.4161/cc.20863. Epub 2012 Jun 15. |