Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of COIL monoclonal antibody (M05A), clone 4B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about COIL monoclonal antibody (M05A), clone 4B8
| Brand: | Abnova |
| Reference: | H00008161-M05A |
| Product name: | COIL monoclonal antibody (M05A), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COIL. |
| Clone: | 4B8 |
| Isotype: | IgM Kappa |
| Gene id: | 8161 |
| Gene name: | COIL |
| Gene alias: | CLN80|p80-coilin |
| Gene description: | coilin |
| Genbank accession: | NM_004645 |
| Immunogen: | COIL (NP_004636, 477 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP |
| Protein accession: | NP_004636 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | COIL monoclonal antibody (M05A), clone 4B8 Western Blot analysis of COIL expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |