Brand: | Abnova |
Reference: | H00008153-M01 |
Product name: | RND2 monoclonal antibody (M01), clone 2D12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RND2. |
Clone: | 2D12 |
Isotype: | IgG2b Kappa |
Gene id: | 8153 |
Gene name: | RND2 |
Gene alias: | ARHN|RHO7|RhoN |
Gene description: | Rho family GTPase 2 |
Genbank accession: | BC018096 |
Immunogen: | RND2 (AAH18096, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM |
Protein accession: | AAH18096 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008153-M01-9-21-1.jpg](http://www.abnova.com/application_image/H00008153-M01-9-21-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged RND2 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |