Brand: | Abnova |
Reference: | H00008128-M01 |
Product name: | ST8SIA2 monoclonal antibody (M01), clone 6G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ST8SIA2. |
Clone: | 6G6 |
Isotype: | IgG2a Kappa |
Gene id: | 8128 |
Gene name: | ST8SIA2 |
Gene alias: | HsT19690|MGC116854|MGC116857|SIAT8B|ST8SIA-II|STX |
Gene description: | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 |
Genbank accession: | NM_006011 |
Immunogen: | ST8SIA2 (NP_006002, 40 a.a. ~ 146 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRT |
Protein accession: | NP_006002 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ST8SIA2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |