Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ANP32A monoclonal antibody (M01), clone 2G11-4A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
More info about ANP32A monoclonal antibody (M01), clone 2G11-4A5
| Brand: | Abnova |
| Reference: | H00008125-M01 |
| Product name: | ANP32A monoclonal antibody (M01), clone 2G11-4A5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ANP32A. |
| Clone: | 2G11-4A5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8125 |
| Gene name: | ANP32A |
| Gene alias: | C15orf1|I1PP2A|LANP|MAPM|MGC119787|MGC150373|PHAP1|PHAPI|PP32 |
| Gene description: | acidic (leucine-rich) nuclear phosphoprotein 32 family, member A |
| Genbank accession: | BC007200 |
| Immunogen: | ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD |
| Protein accession: | AAH07200 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action.Cheng PC, Chang HK, Chen SH. Mol Cell Proteomics. 2009 Oct 5. [Epub ahead of print] |